DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and CIPK23

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_564353.1 Gene:CIPK23 / 839907 AraportID:AT1G30270 Length:482 Species:Arabidopsis thaliana


Alignment Length:394 Identity:118/394 - (29%)
Similarity:190/394 - (48%) Gaps:49/394 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIALLKQLKHRHV 233
            ||||.:|..||||::.|||.|.|.||...:|:|::.|.|:.:.....| :.|||:.:|.:||.:|
plant    28 VGKYELGRTLGEGTFAKVKFARNVENGDNVAIKVIDKEKVLKNKMIAQ-IKREISTMKLIKHPNV 91

  Fly   234 VELVDVLYNEEKQKMYLVMEYCVGGLQEMID-YQPDKRMPLFQAHGYFKQLVDGLEYLHSCRVIH 297
            :.:.:|:  ..|.|:|.|:|:..||  |:.| ...:.|:...:|..||:||::.::|.||..|.|
plant    92 IRMFEVM--ASKTKIYFVLEFVTGG--ELFDKISSNGRLKEDEARKYFQQLINAVDYCHSRGVYH 152

  Fly   298 KDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQGSPAFQPPEIANGHETFAGFKVDIW 362
            :|:||.||||..:..||:||||::........|....|..|:|.:..||:.| ::.:.|.|.|:|
plant   153 RDLKPENLLLDANGALKVSDFGLSALPQQVREDGLLHTTCGTPNYVAPEVIN-NKGYDGAKADLW 216

  Fly   363 SSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADFANLILGMLQADPSKRLSLQ 427
            |.||.|:.|..|..|||..|:..|.:.|.:.::..|.|   ..|....||..:|..:|:.|::..
plant   217 SCGVILFVLMAGYLPFEDSNLTSLYKKIFKAEFTCPPW---FSASAKKLIKRILDPNPATRITFA 278

  Fly   428 EIRHDTWFRSAPVKTGPPIPIPPLKGDKYRNSTVIPYLEAYHYGTQEEDVYFTEHDVNQELARQA 492
            |:..:.||:..            .|..|:.|:.|         ...:.|..|.:...::.|..: 
plant   279 EVIENEWFKKG------------YKAPKFENADV---------SLDDVDAIFDDSGESKNLVVE- 321

  Fly   493 AAAASEIRAKQSAAALAACHTYEPPSTSAAAASNSLGNGSREEAPVKKKGSALKRRAKKLTSCIS 557
                   |.::........:.:|..||     |..|..||..|     |...|.:|..:.||..|
plant   322 -------RREEGLKTPVTMNAFELIST-----SQGLNLGSLFE-----KQMGLVKRKTRFTSKSS 369

  Fly   558 VRKL 561
            ..::
plant   370 ANEI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 91/263 (35%)
STKc_LKB1 178..435 CDD:271021 89/257 (35%)
CIPK23NP_564353.1 STKc_SnRK3 30..285 CDD:271133 92/263 (35%)
CIPK_C 334..449 CDD:213380 14/50 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.