DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and CIPK19

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_199393.1 Gene:CIPK19 / 834621 AraportID:AT5G45810 Length:483 Species:Arabidopsis thaliana


Alignment Length:437 Identity:129/437 - (29%)
Similarity:210/437 - (48%) Gaps:68/437 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 QKKKSIK-----------MVGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNG 214
            :|.||||           ::|||.||.:||.|::.||..|.|:::...:|:|::.|.|:  :.:|
plant     6 RKVKSIKKKQDQSNHQALILGKYEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKV--LKSG 68

  Fly   215 -EQNVTREIALLKQLKHRHVVELVDVLYNEEKQKMYLVMEYCVGGLQEMIDYQPDKRMPLFQAHG 278
             ..::.|||::|::::|.::|:|.:|:  ..|.|:|.||||..||  |:.:.....|:....|..
plant    69 LIAHIKREISILRRVRHPNIVQLFEVM--ATKSKIYFVMEYVKGG--ELFNKVAKGRLKEEMARK 129

  Fly   279 YFKQLVDGLEYLHSCRVIHKDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQGSPAFQ 343
            ||:||:..:.:.|...|.|:|:||.||||..:..||:||||::...|....|....|..|:||:.
plant   130 YFQQLISAVSFCHFRGVYHRDLKPENLLLDENGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYV 194

  Fly   344 PPEIANGHETFAGFKVDIWSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADF 408
            .||:. ..:.:.|.||||||.||.|:.|..|..||...|:..:.:.|.||.:..|.|   ...:.
plant   195 APEVL-ARKGYDGAKVDIWSCGVILFVLMAGFLPFHDRNVMAMYKKIYRGDFRCPRW---FPVEI 255

  Fly   409 ANLILGMLQADPSKRLSLQEIRHDTWFRSAPVKTGPPIPIPPLKGDKYRNSTVIPYLEAYHYGTQ 473
            ..|::.||:..|.:|.::.:|...:||:               ||.|:    :..|:|..|....
plant   256 NRLLIRMLETKPERRFTMPDIMETSWFK---------------KGFKH----IKFYVEDDHQLCN 301

  Fly   474 EEDVYFTEHDVNQELARQAAAAASEI------------RAKQSAAALAACHTYEPPSTSAAAASN 526
            ..|      |...|.....:..:|.:            |...|....|:.:.::..|.|.....:
plant   302 VAD------DDEIESIESVSGRSSTVSEPEDFESFDGRRRGGSMPRPASLNAFDLISFSPGFDLS 360

  Fly   527 SL----GNGSR--EEAPVKKKGSALKRRAKKLTSCISVRKLSHCRTS 567
            .|    |.|||  ..|||.:..|.|:..|:.::  .:||| ..|:.|
plant   361 GLFEDDGEGSRFVSGAPVGQIISKLEEIARIVS--FTVRK-KDCKVS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 89/263 (34%)
STKc_LKB1 178..435 CDD:271021 86/257 (33%)
CIPK19NP_199393.1 STKc_SnRK3 27..281 CDD:271133 90/263 (34%)
CIPK_C 346..458 CDD:213380 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.