DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and SnRK1.3

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_198760.1 Gene:SnRK1.3 / 833940 AraportID:AT5G39440 Length:494 Species:Arabidopsis thaliana


Alignment Length:290 Identity:104/290 - (35%)
Similarity:158/290 - (54%) Gaps:19/290 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 KSIKMVGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIALLKQL 228
            |.:.::..|.:|..||.||:.|||.|::.....::|:|||.:.|::.: ..|..|.|||.:|:.|
plant    11 KLVSILPNYRIGKTLGHGSFAKVKLALHVATGHKVAIKILNRSKIKNM-GIEIKVQREIKILRFL 74

  Fly   229 KHRHVVELVDVLYNEEKQKMYLVMEYCVGGLQEMIDYQPDK-RMPLFQAHGYFKQLVDGLEYLHS 292
            .|.|::...:|:  |....:|:||||...|  |:.||..:| ::...:|...|:|::.|:||.|.
plant    75 MHPHIIRQYEVI--ETPNDIYVVMEYVKSG--ELFDYIVEKGKLQEDEARHLFQQIISGVEYCHR 135

  Fly   293 CRVIHKDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQGSPAFQPPEIANGHETFAGF 357
            ..::|:|:||.|:||.....:||.|||::   ::........|..|||.:..||:.:|..  .|.
plant   136 NMIVHRDLKPENVLLDSQCNIKIVDFGLS---NVMHDGHFLKTSCGSPNYAAPEVISGKP--YGP 195

  Fly   358 KVDIWSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADFANLILGMLQADPSK 422
            .|||||.||.||.|..|..||:.:||..:.|.|.||.:..|..|.....|   ||..||..||:.
plant   196 DVDIWSCGVILYALLCGTLPFDDENIPNVFEKIKRGMYTLPNHLSHFARD---LIPRMLMVDPTM 257

  Fly   423 RLSLQEIRHDTWFRS-APVKTGPPIPIPPL 451
            |:|:.|||...||.: .|:.    :.||||
plant   258 RISITEIRQHPWFNNHLPLY----LSIPPL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 96/263 (37%)
STKc_LKB1 178..435 CDD:271021 94/257 (37%)
SnRK1.3NP_198760.1 STKc_AMPK_alpha 16..270 CDD:270981 96/266 (36%)
UBA_SnRK1_plant 292..332 CDD:270520
AMPKA_C 388..491 CDD:213378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.