DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and CIPK25

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_568466.1 Gene:CIPK25 / 832582 AraportID:AT5G25110 Length:488 Species:Arabidopsis thaliana


Alignment Length:298 Identity:97/298 - (32%)
Similarity:169/298 - (56%) Gaps:18/298 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 NRVDSQDIIYQQKKKSIKMVGKYIMGDVLGEGSYGKV---KEAMNSENLCRLAVKILTKRKLRRI 211
            :|..|...:.:::::...:..||.||.:||:|::|||   ||....|:   :|:||:.|.:::|.
plant    21 SRYQSAPTMEEEQQQLRVLFAKYEMGRLLGKGTFGKVYYGKEITTGES---VAIKIINKDQVKRE 82

  Fly   212 PNGEQNVTREIALLKQLKHRHVVELVDVLYNEEKQKMYLVMEYCVGGLQEMIDYQPDKRMPLFQA 276
            ...|| :.|||::::.::|.::|||.:|:  ..|.|::.:|||..||  |:.......::....|
plant    83 GMMEQ-IKREISIMRLVRHPNIVELKEVM--ATKTKIFFIMEYVKGG--ELFSKIVKGKLKEDSA 142

  Fly   277 HGYFKQLVDGLEYLHSCRVIHKDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQGSPA 341
            ..||:||:..:::.||..|.|:|:||.|||:..:..||:||||::...:....|....|..|:||
plant   143 RKYFQQLISAVDFCHSRGVSHRDLKPENLLVDENGDLKVSDFGLSALPEQILQDGLLHTQCGTPA 207

  Fly   342 FQPPEIANGHETFAGFKVDIWSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDA 406
            :..||:.. .:.:.|.|.||||.|:.||.|..|..||:.:|:.::...|.:.::|.|.|   ...
plant   208 YVAPEVLR-KKGYDGAKGDIWSCGIILYVLLAGFLPFQDENLMKMYRKIFKSEFEYPPW---FSP 268

  Fly   407 DFANLILGMLQADPSKRLSLQEIRHDTWFR---SAPVK 441
            :...||..:|..||:||:|:..|....|||   ::|::
plant   269 ESKRLISKLLVVDPNKRISIPAIMRTPWFRKNINSPIE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 90/265 (34%)
STKc_LKB1 178..435 CDD:271021 87/259 (34%)
CIPK25NP_568466.1 STKc_SnRK3 42..296 CDD:271133 91/265 (34%)
S_TKc 43..297 CDD:214567 90/265 (34%)
CIPK_C 342..455 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.