DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and CIPK7

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_188940.1 Gene:CIPK7 / 821874 AraportID:AT3G23000 Length:429 Species:Arabidopsis thaliana


Alignment Length:277 Identity:95/277 - (34%)
Similarity:149/277 - (53%) Gaps:20/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 MVGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNG-EQNVTREIALLKQLKHR 231
            ::|||.:|..||.||:.||..|.:.|:...:||||:.|:|  .|.:| |..:.|||..:::|:|.
plant    21 LLGKYELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKK--TIESGMEPRIIREIDAMRRLRHH 83

  Fly   232 -HVVELVDVLYNEEKQKMYLVMEYCVGGLQEMIDYQPDK-RMPLFQAHGYFKQLVDGLEYLHSCR 294
             :::::.:|:  ..|.|:|||||...||  |:......: |:|...|..||:||...|.:.|...
plant    84 PNILKIHEVM--ATKSKIYLVMELASGG--ELFSKVLRRGRLPESTARRYFQQLASALRFSHQDG 144

  Fly   295 VIHKDIKPGNLLLSLDQTLKISDFGVA---EQLDLFAPDDTCTTGQGSPAFQPPEIANGHETFAG 356
            |.|:|:||.||||.....||:||||::   |.|.    :....|..|:||:..||:.: ...:.|
plant   145 VAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQ----NGLLHTACGTPAYTAPEVIS-RRGYDG 204

  Fly   357 FKVDIWSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADFANLILGMLQADPS 421
            .|.|.||.||.|:.|..|..||:..||..:...|.|..:..|:|:   .....::|..||..:|.
plant   205 AKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHRRDYRFPSWI---SKQAKSIIYQMLDPNPV 266

  Fly   422 KRLSLQEIRHDTWFRSA 438
            .|:|::.:....||:.:
plant   267 TRMSIETVMKTNWFKKS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 91/268 (34%)
STKc_LKB1 178..435 CDD:271021 89/262 (34%)
CIPK7NP_188940.1 PKc_like 24..279 CDD:419665 92/268 (34%)
CIPK_C 308..>385 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.