DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and SIP4

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_180595.1 Gene:SIP4 / 817586 AraportID:AT2G30360 Length:435 Species:Arabidopsis thaliana


Alignment Length:407 Identity:118/407 - (28%)
Similarity:187/407 - (45%) Gaps:96/407 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DSQDIIYQQKKKSIKMVGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQN 217
            |:.|.::          |||.:|.:||.|::.||..|.:......:|||||.|:||...|....|
plant    12 DNNDALF----------GKYELGKLLGCGAFAKVFHARDRRTGQSVAVKILNKKKLLTNPALANN 66

  Fly   218 VTREIALLKQLKHRHVVELVDVLYNEEKQKMYLVMEYCVGGLQEMIDYQPDKRMPLFQAHG---- 278
            :.|||:::::|.|.::|:|.:|:  ..|.|::..||:..||  |:.:        ....||    
plant    67 IKREISIMRRLSHPNIVKLHEVM--ATKSKIFFAMEFVKGG--ELFN--------KISKHGRLSE 119

  Fly   279 -----YFKQLVDGLEYLHSCRVIHKDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQG 338
                 ||:||:..:.|.|:..|.|:|:||.|||:..:..||:||||::...|...||....|..|
plant   120 DLSRRYFQQLISAVGYCHARGVYHRDLKPENLLIDENGNLKVSDFGLSALTDQIRPDGLLHTLCG 184

  Fly   339 SPAFQPPEIAN--GHETFAGFKVDIWSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWL 401
            :||:..|||.:  |:|   |.|||:||.|:.|:.|..|..||...|:..:.:.|.:|::..|.| 
plant   185 TPAYVAPEILSKKGYE---GAKVDVWSCGIVLFVLVAGYLPFNDPNVMNMYKKIYKGEYRFPRW- 245

  Fly   402 YEMDADFANLILGMLQADPSKRLSLQEIRHDTWFRSAPVKTGPPIPIPPLKGDKYRNSTVIPYLE 466
              |..|....:..:|..:|..|:::.||..|.||    |:.|       .|..|:          
plant   246 --MSPDLKRFVSRLLDINPETRITIDEILKDPWF----VRGG-------FKQIKF---------- 287

  Fly   467 AYHYGTQEEDVYFTEHDVNQELARQAAAAASEIRAKQSAAALAACHTYEPPSTSA--------AA 523
                           ||  .|:..|        :.:.|..|:.:.:.::..|.|:        |.
plant   288 ---------------HD--DEIEDQ--------KVESSLEAVKSLNAFDLISYSSGLDLSGLFAG 327

  Fly   524 ASNSLGNGSR---EEAP 537
            .|||.|...|   |::|
plant   328 CSNSSGESERFLSEKSP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 92/273 (34%)
STKc_LKB1 178..435 CDD:271021 90/267 (34%)
SIP4NP_180595.1 PKc_like 20..276 CDD:419665 93/273 (34%)
CIPK_C 308..421 CDD:213380 10/37 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.