DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and Prkaa2

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_076481.1 Gene:Prkaa2 / 78975 RGDID:620893 Length:552 Species:Rattus norvegicus


Alignment Length:278 Identity:97/278 - (34%)
Similarity:158/278 - (56%) Gaps:13/278 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 QQKKKSIKMVGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIAL 224
            :||......:|.|::||.||.|::||||...:.....::|||||.::|:|.: :....:.|||..
  Rat     4 KQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSL-DVVGKIKREIQN 67

  Fly   225 LKQLKHRHVVELVDVLYNEEKQKMYLVMEYCVGGLQEMIDY-QPDKRMPLFQAHGYFKQLVDGLE 288
            ||..:|.|:::|..|:  ......::||||..||  |:.|| ....|:...:|...|:|::..::
  Rat    68 LKLFRHPHIIKLYQVI--STPTDFFMVMEYVSGG--ELFDYICKHGRVEEVEARRLFQQILSAVD 128

  Fly   289 YLHSCRVIHKDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQGSPAFQPPEIANGHET 353
            |.|...|:|:|:||.|:||......||:|||::   ::.:..:...|..|||.:..||:.:| ..
  Rat   129 YCHRHMVVHRDLKPENVLLDAQMNAKIADFGLS---NMMSDGEFLRTSCGSPNYAAPEVISG-RL 189

  Fly   354 FAGFKVDIWSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADFANLILGMLQA 418
            :||.:|||||.||.||.|..|..||:.:::..|.:.|..|.:..|.:|   :...|.|::.|||.
  Rat   190 YAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYL---NRSIATLLMHMLQV 251

  Fly   419 DPSKRLSLQEIRHDTWFR 436
            ||.||.::::||...||:
  Rat   252 DPLKRATIKDIREHEWFK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 92/263 (35%)
STKc_LKB1 178..435 CDD:271021 89/257 (35%)
Prkaa2NP_076481.1 STKc_AMPK_alpha 13..268 CDD:270981 93/266 (35%)
S_TKc 16..268 CDD:214567 92/263 (35%)
UBA_AID_AAPK2 285..349 CDD:270587
AIS. /evidence=ECO:0000250 291..376
AMPKA2_C 395..550 CDD:213385
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 478..520
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.