DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and Brsk2

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_001009930.1 Gene:Brsk2 / 75770 MGIID:1923020 Length:719 Species:Mus musculus


Alignment Length:282 Identity:103/282 - (36%)
Similarity:161/282 - (57%) Gaps:14/282 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIALLKQLKHRHV 233
            ||.|.:...||:|..|.||..::.....::|:||:.:.||..  :....|.||||:||.::|.||
Mouse    17 VGPYRLEKTLGKGQTGLVKLGIHCVTCQKVAIKIVNREKLSE--SVLMKVEREIAILKLIEHPHV 79

  Fly   234 VELVDVLYNEEKQKMYLVMEYCVGGLQEMIDYQPDK-RMPLFQAHGYFKQLVDGLEYLHSCRVIH 297
            ::|.||.  |.|:.:|||:|:..||  |:.||...| |:...:|..:|:|::..|::.||..:.|
Mouse    80 LKLHDVY--ENKKYLYLVLEHVSGG--ELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSICH 140

  Fly   298 KDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQGSPAFQPPEIANGHETFAGFKVDIW 362
            :|:||.||||.....::|:|||:|   .|...|....|..|||.:..||:..| |.:.|.|.|:|
Mouse   141 RDLKPENLLLDERNNIRIADFGMA---SLQVGDSLLETSCGSPHYACPEVIRG-EKYDGRKADVW 201

  Fly   363 SSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADFANLILGMLQADPSKRLSLQ 427
            |.||.|:.|..|..||:.||:.:|||.:.||.:..|.::   ..|..:|:.||::.|.::||:|:
Mouse   202 SCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFI---PPDCQSLLRGMIEVDAARRLTLE 263

  Fly   428 EIRHDTWFRSAPVKTGPPIPIP 449
            .|:...|:.....:..|..|||
Mouse   264 HIQKHIWYIGGKNEPEPEQPIP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 96/263 (37%)
STKc_LKB1 178..435 CDD:271021 95/257 (37%)
Brsk2NP_001009930.1 STKc_BRSK1_2 18..271 CDD:270983 97/265 (37%)
UBA_BRSK 298..351 CDD:270525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.