DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and Prkaa1

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_062015.2 Gene:Prkaa1 / 65248 RGDID:3387 Length:559 Species:Rattus norvegicus


Alignment Length:278 Identity:99/278 - (35%)
Similarity:161/278 - (57%) Gaps:13/278 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 QQKKKSIKMVGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIAL 224
            :||......:|.||:||.||.|::||||...:.....::|||||.::|:|.: :....:.|||..
  Rat    15 KQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSL-DVVGKIRREIQN 78

  Fly   225 LKQLKHRHVVELVDVLYNEEKQKMYLVMEYCVGGLQEMIDY-QPDKRMPLFQAHGYFKQLVDGLE 288
            ||..:|.|:::|..|:  .....:::||||..||  |:.|| ..:.|:...::...|:|::.|::
  Rat    79 LKLFRHPHIIKLYQVI--STPSDIFMVMEYVSGG--ELFDYICKNGRLDEKESRRLFQQILSGVD 139

  Fly   289 YLHSCRVIHKDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQGSPAFQPPEIANGHET 353
            |.|...|:|:|:||.|:||......||:|||::   ::.:..:...|..|||.:..||:.:| ..
  Rat   140 YCHRHMVVHRDLKPENVLLDAHMNAKIADFGLS---NMMSDGEFLRTSCGSPNYAAPEVISG-RL 200

  Fly   354 FAGFKVDIWSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADFANLILGMLQA 418
            :||.:||||||||.||.|..|..||:.|::..|.:.|..|.:..|.:|   :....:|:..|||.
  Rat   201 YAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYL---NPSVISLLKHMLQV 262

  Fly   419 DPSKRLSLQEIRHDTWFR 436
            ||.||.::::||...||:
  Rat   263 DPMKRATIKDIREHEWFK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 94/263 (36%)
STKc_LKB1 178..435 CDD:271021 90/257 (35%)
Prkaa1NP_062015.2 STKc_AMPK_alpha 24..279 CDD:270981 95/266 (36%)
UBA_AID_AAPK1 296..360 CDD:270586
AIS. /evidence=ECO:0000250 302..381
AMPKA1_C 404..557 CDD:213384
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..536
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.