DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and mark4b

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:XP_005157655.1 Gene:mark4b / 571279 ZFINID:ZDB-GENE-100330-2 Length:796 Species:Danio rerio


Alignment Length:391 Identity:117/391 - (29%)
Similarity:191/391 - (48%) Gaps:63/391 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIALLKQLKHRHV 233
            :|.|.:...:|:|::.|||.|.:......:|:||:.|.:|.  |...|.:.||:.::|.|.|.::
Zfish    55 IGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLN--PTSLQKLFREVRIMKGLNHPNI 117

  Fly   234 VELVDVLYNEEKQKMYLVMEYCVGGLQEMIDYQPDK-RMPLFQAHGYFKQLVDGLEYLHSCRVIH 297
            |:|.:|:  |.::.:||||||..||  |:.||.... ||...:|.|.|:|:|..:.|.|...::|
Zfish   118 VQLFEVI--ETEKTLYLVMEYASGG--EVFDYLVSHGRMKEKEARGKFRQIVSAVHYCHLKNIVH 178

  Fly   298 KDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDT-CTTGQGSPAFQPPEIANGHETFAGFKVDI 361
            :|:|..||||..|..:||:|||.:.:..|.:..|| |    |||.:..||:..| :.:.|.:|||
Zfish   179 RDLKAENLLLDADSNIKIADFGFSNEFTLGSKLDTFC----GSPPYAAPELFQG-KKYDGPEVDI 238

  Fly   362 WSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADFANLILGMLQADPSKRLSL 426
            ||.||.||.|.:|..||:|.|:..|.|.:.||::..|   :.|..|...::...|..:|:||.:|
Zfish   239 WSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRVP---FYMSTDCEGILRRFLVLNPTKRCTL 300

  Fly   427 QEIRHDTWFRSAPVKTGPPIPIPPLKGDKYRNSTVIPYLEAY--HYGTQEEDVY----FTEHDVN 485
            ::|..|.|....                 |.|..:.||:|..  :..|...||.    ::..::.
Zfish   301 EQIMKDKWMNVG-----------------YENDELKPYIEPVEDYNDTSRVDVMVGMGYSRDEIK 348

  Fly   486 QELARQ-----------------------AAAAASEIRAKQSAAALAAC-HTYEPPSTSAAAASN 526
            ..|..|                       ::::.|..|.:.||...... |:....|:|.:|:|:
Zfish   349 DALTTQKYNEIFATYLLLGRKNEDGMESRSSSSLSLARVRPSAITNGTSKHSSTSSSSSTSASSH 413

  Fly   527 S 527
            :
Zfish   414 T 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 96/264 (36%)
STKc_LKB1 178..435 CDD:271021 95/258 (37%)
mark4bXP_005157655.1 STKc_MARK 57..309 CDD:270974 96/265 (36%)
S_TKc 58..309 CDD:214567 96/264 (36%)
UBA_like_SF 327..369 CDD:304366 5/41 (12%)
MARK4_C 699..796 CDD:213382
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.