DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and brsk1a

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:XP_693123.4 Gene:brsk1a / 564701 ZFINID:ZDB-GENE-121214-354 Length:746 Species:Danio rerio


Alignment Length:286 Identity:101/286 - (35%)
Similarity:161/286 - (56%) Gaps:17/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 KSIKMVGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIALLKQL 228
            ::.:.||.|.:...||:|..|.||..::.....::|:||:.:.||..  :....|.||||:||.:
Zfish     9 QAAQYVGPYRLEKTLGKGQTGLVKLGIHCITSQKVAIKIVNREKLSE--SVLMKVEREIAILKLI 71

  Fly   229 KHRHVVELVDVLYNEEKQKMYLVMEYCVGGLQEMIDYQPDK-RMPLFQAHGYFKQLVDGLEYLHS 292
            :|.||::|.||.  |..:.:|||:|:..||  |:.||...| |:...:|..:|:|::..|::.||
Zfish    72 EHPHVLKLHDVY--ENNKYLYLVLEHVSGG--ELFDYLVKKGRLTPKEARKFFRQIISALDFCHS 132

  Fly   293 CRVIHKDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQGSPAFQPPEIANGHETFAGF 357
            ..:.|:|:||.||||.....::|:|||:|   .|...|....|..|||.:..||:..| |.:.|.
Zfish   133 HSICHRDLKPENLLLDERNNIRIADFGMA---SLQVGDSLLETSCGSPHYACPEVIRG-EKYDGR 193

  Fly   358 KVDIWSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYEMDADFANLILGMLQADPSK 422
            :.|:||.||.|:.|..|..||:.||:.:|||.:..|.:..|.::   ..|...|:.||::.:|.|
Zfish   194 RADVWSCGVILFALLVGALPFDHDNLRQLLEKVKSGVFHMPHFI---PPDCQALLRGMIEVNPEK 255

  Fly   423 RLSLQEIRHDTWF---RSAPVKTGPP 445
            ||:|:.|:...|:   |:.|....||
Zfish   256 RLTLEAIQKHAWYQAGRNEPCPEQPP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 94/263 (36%)
STKc_LKB1 178..435 CDD:271021 93/257 (36%)
brsk1aXP_693123.4 STKc_BRSK1_2 15..268 CDD:270983 95/265 (36%)
S_TKc 17..267 CDD:214567 94/262 (36%)
UBA_BRSK 295..348 CDD:270525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.