DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and PRKAA1

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_996790.3 Gene:PRKAA1 / 5562 HGNCID:9376 Length:574 Species:Homo sapiens


Alignment Length:293 Identity:100/293 - (34%)
Similarity:162/293 - (55%) Gaps:28/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 QQKKKSIKMVGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIAL 224
            :||......:|.||:||.||.|::||||...:.....::|||||.::|:|.: :....:.|||..
Human    15 KQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSL-DVVGKIRREIQN 78

  Fly   225 LKQLKHRHVVELVDVLYNEEKQKMYLVMEYCVGGLQEMIDY------QPD----------KRMPL 273
            ||..:|.|:::|..|:  .....:::||||..||  |:.||      :.|          |.:..
Human    79 LKLFRHPHIIKLYQVI--STPSDIFMVMEYVSGG--ELFDYICKNGRKSDVPGVVKTGSTKELDE 139

  Fly   274 FQAHGYFKQLVDGLEYLHSCRVIHKDIKPGNLLLSLDQTLKISDFGVAEQLDLFAPDDTCTTGQG 338
            .::...|:|::.|::|.|...|:|:|:||.|:||......||:|||::   ::.:..:...|..|
Human   140 KESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLS---NMMSDGEFLRTSCG 201

  Fly   339 SPAFQPPEIANGHETFAGFKVDIWSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAWLYE 403
            ||.:..||:.:| ..:||.:||||||||.||.|..|..||:.|::..|.:.|..|.:..|.:|  
Human   202 SPNYAAPEVISG-RLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYL-- 263

  Fly   404 MDADFANLILGMLQADPSKRLSLQEIRHDTWFR 436
             :....:|:..|||.||.||.::::||...||:
Human   264 -NPSVISLLKHMLQVDPMKRATIKDIREHEWFK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 95/278 (34%)
STKc_LKB1 178..435 CDD:271021 91/272 (33%)
PRKAA1NP_996790.3 STKc_AMPK_alpha 24..294 CDD:270981 96/281 (34%)
UBA_AID_AAPK1 311..375 CDD:270586
AMPKA1_C 419..572 CDD:213384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.