DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and lok

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster


Alignment Length:449 Identity:117/449 - (26%)
Similarity:190/449 - (42%) Gaps:94/449 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EPDPVEDEMTVLLANKNF----------------HYDVASDLDDDAFVELKEDTAQADDAGAGVG 109
            |..|:|..:...|..||.                |...:.||::|.|.             ||.|
  Fly    23 ESQPMEKIVWGRLYGKNIKIKSLGTSSKYRIIYTHSSFSVDLNNDEFT-------------AGRG 74

  Fly   110 FYNPDELLLDDQPHPQVTWLDDDEIETLDRVTLDMGNMFF------------------NR---VD 153
            ..|...|.|:|.|...:|.:..... .:.|...::.|..:                  ||   :.
  Fly    75 EANDLILTLNDLPEKILTRISKVHF-IIKRANCELTNPVYIQDLSRNGTFVNNEKIGTNRMRILK 138

  Fly   154 SQDII------YQ-------QKKKSIKM---VGK-YIMGDVLGEGSYGKVKEAMNSENLCRLAVK 201
            :.|:|      |:       ...:||.:   :.| |.:...||.|:||.|:...::....:.|:|
  Fly   139 NDDVISLSHPTYKAFVFKDLSPNESIGLPEEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMK 203

  Fly   202 ILTKRKL---RRIPN--GEQNVTREIALLKQLKHRHVVELVDVLYNEEKQKMYLVMEYCVGG--L 259
            |:.|..|   |...|  ....|..|..::|.|.|..||.:.|::  ::...:|:|:|:..||  |
  Fly   204 IVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHPCVVRMHDIV--DKPDSVYMVLEFMRGGDLL 266

  Fly   260 QEMIDYQPDKRMPLFQAHGYFKQLVDGLEYLHSCRVIHKDIKPGNLLLSL---DQTLKISDFGVA 321
            ..:|.   :|.:....:..||.|:...::|||...:.|:|:||.|:||..   :..||:||||::
  Fly   267 NRIIS---NKLLSEDISKLYFYQMCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLS 328

  Fly   322 EQLDLFAPDDTCTTGQGSPAFQPPE--IANGHETFAGFKVDIWSSGVTLYNLATGQYPFEGDNIY 384
            :   ....|....|..|:|.:..||  |..|.|.:.. ||||||.||.|:...:|..||..:...
  Fly   329 K---FVQKDSVMRTLCGTPLYVAPEVLITGGREAYTK-KVDIWSLGVVLFTCLSGTLPFSDEYGT 389

  Fly   385 RLLENI--GRGQWEAPAWLYEMDADFANLILG-MLQADPSKRLSLQEIRHDTWFRSAPV 440
            ...:.|  ||..:..|:|  :..:..|.|::. ||..||.:|.|:.::...:|.|.||:
  Fly   390 PAAQQIKKGRFAYGHPSW--KSVSQRAKLLINQMLIVDPERRPSIDDVLQSSWLRDAPM 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 83/277 (30%)
STKc_LKB1 178..435 CDD:271021 82/271 (30%)
lokNP_477219.1 FHA 39..156 CDD:238017 22/130 (17%)
STKc_Chk2 167..441 CDD:270986 84/284 (30%)
S_TKc 174..441 CDD:214567 83/277 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.