DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and ppk34

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_588482.2 Gene:ppk34 / 3361146 PomBaseID:SPCC1919.01 Length:354 Species:Schizosaccharomyces pombe


Alignment Length:303 Identity:92/303 - (30%)
Similarity:145/303 - (47%) Gaps:48/303 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 MVGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRR---------------------- 210
            ::.:|.:.::||.|:...|..|::.......|:|...|..|||                      
pombe    36 LLKQYRLKNMLGYGACSTVYLAVDVSTNIEYAIKEFKKTSLRRREKFRLMQLEKELGSFNDMDSS 100

  Fly   211 -----IPNGEQN-----VTREIALLKQLKHRHVVELVDVLYNEEKQKMYLVMEYCVGGLQEMID- 264
                 |.|.|:.     :.:|:.:||.|.|.:||:|..|:.::.|..:.:|:.||.||....:| 
pombe   101 TIEDQIRNQEKKDPYYYIRKELDVLKVLDHENVVKLYQVINSDYKDSLCMVLNYCPGGKLASVDH 165

  Fly   265 ---YQPDKRMPLFQAHGYFKQLVDGLEYLHSCRVIHKDIKPGNLLLSLDQTLKISDFGVAEQLDL 326
               :.|   |||......|:|||..:.|:|...|||:||||.|:|...:..|.:.|||:||    
pombe   166 GISFDP---MPLETCRKSFRQLVLAVNYIHGKGVIHRDIKPDNILFKENNNLCVIDFGLAE---- 223

  Fly   327 FAP-DDTCTTGQGSPAFQPPEI-ANGHETFAGFKVDIWSSGVTLYNLATGQYPFEGDNIYRLLEN 389
            |.| |.......|:|||..||: .|..:...|..:||||.|||||.:|..::||.|..|..::..
pombe   224 FLPKDGFVKPASGTPAFMAPELFDNELKKIKGKPLDIWSMGVTLYVIAFAEFPFNGSTILDMINV 288

  Fly   390 IGRGQWEAPAWLYEMDADFANLILGMLQADPSKRLSLQEIRHD 432
            |.......||:   .::|...|:...|:.:|.||::::|:..|
pombe   289 IKGKSLMIPAY---CNSDLRKLLERCLEKNPEKRITIEELLRD 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567 92/299 (31%)
STKc_LKB1 178..435 CDD:271021 91/293 (31%)
ppk34NP_588482.2 S_TKc 40..331 CDD:214567 92/299 (31%)
STKc_LKB1_CaMKK 46..331 CDD:270910 91/293 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104622
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.