DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lkb1 and AgaP_AGAP012859

DIOPT Version :9

Sequence 1:NP_001163606.1 Gene:Lkb1 / 41673 FlyBaseID:FBgn0038167 Length:567 Species:Drosophila melanogaster
Sequence 2:XP_561487.4 Gene:AgaP_AGAP012859 / 3292646 VectorBaseID:AGAP012859 Length:128 Species:Anopheles gambiae


Alignment Length:127 Identity:34/127 - (26%)
Similarity:51/127 - (40%) Gaps:38/127 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 YFTEHDVNQELARQAAAAASE----IRAKQSAAAL--AACHT-------------YEPPSTSAAA 523
            |:||||:| |:|||...:.:|    .||...|..:  .:.||             |..|::.:..
Mosquito     3 YYTEHDIN-EMARQQYDSYTEGGLYDRAYLPAPTMDSLSFHTDDQGSETGLRRAYYNQPNSGSGR 66

  Fly   524 AS------------------NSLGNGSREEAPVKKKGSALKRRAKKLTSCISVRKLSHCRTS 567
            ::                  :.:|.............|:.|||::|..||||.||..|||.|
Mosquito    67 STVEKRPSRSFSLSPKPSIRHMIGTSCPATTANSSSSSSGKRRSRKTVSCISWRKWPHCRQS 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lkb1NP_001163606.1 S_TKc 172..435 CDD:214567
STKc_LKB1 178..435 CDD:271021
AgaP_AGAP012859XP_561487.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 79 1.000 Domainoid score I15493
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D24491at7147
OrthoFinder 1 1.000 - - FOG0006218
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.