DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and HTRA3

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_444272.1 Gene:HTRA3 / 94031 HGNCID:30406 Length:453 Species:Homo sapiens


Alignment Length:199 Identity:43/199 - (21%)
Similarity:77/199 - (38%) Gaps:53/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RNGQILAAND------------NVGMS-GPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELM 78
            |.|:.|...|            |.|.| ||||:.:|   ..|.:..:::.......:.:|     
Human   279 REGRELGLRDSDMDYIQTDAIINYGNSGGPLVNLDG---EVIGINTLKVTAGISFAIPSD----- 335

  Fly    79 NQIQTLLNQYHSE-------------IATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVV 130
             :|...|.::..:             :.|..|.||:...|.:.|......|            :.
Human   336 -RITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSG------------IY 387

  Fly   131 VNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLI 195
            |..|:|:||::|.|:..||.|::.    :|....|.:::.|.|  :....:.|:|:||...|...
Human   388 VQEVAPNSPSQRGGIQDGDIIVKV----NGRPLVDSSELQEAV--LTESPLLLEVRRGNDDLLFS 446

  Fly   196 LVPK 199
            :.|:
Human   447 IAPE 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 16/69 (23%)
HTRA3NP_444272.1 IGFBP 25..76 CDD:278641
Kazal_2 81..126 CDD:284958
Serine protease 175..340 15/69 (22%)
Trypsin_2 175..319 CDD:290102 13/42 (31%)
PDZ_serine_protease 355..440 CDD:238487 24/102 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.