DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and NMA111

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_014276.1 Gene:NMA111 / 855600 SGDID:S000005067 Length:997 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:47/224 - (20%)
Similarity:79/224 - (35%) Gaps:73/224 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTTTKERLERLINAKKQLEAQINRNGQI-----------LAANDNVGMSG-PLVDAEGF------ 50
            |....|:|..|.....:::......|::           .||:.:.|.|| |:|:.:|:      
Yeast   188 GNDAGEKLSILAGFISRIDRNAPEYGELTYNDFNTEYIQAAASASGGSSGSPVVNIDGYAVALQA 252

  Fly    51 -----PRNDIDVYQVRLARQTIICLQNDHKELMN---QIQTLLNQYHSEIATTDPELVNRASALD 107
                 ...|..:...|:.| .:||:|. :|.:..   |:|.||..|            :....|.
Yeast   253 GGSTEASTDFFLPLDRILR-ALICIQT-NKPITRGTIQVQWLLKPY------------DECRRLG 303

  Fly   108 LDSDRSPGGANITDLAPARAIVVVNLVSPDSPAERAGLCAGDAILRFG-------------SINS 159
            |.|:|.         :.|||....|:          ||...:.:||.|             ||| 
Yeast   304 LTSERE---------SEARAKFPENI----------GLLVAETVLREGPGYDKIKEGDTLISIN- 348

  Fly   160 GNFKGDLAQIGELVRNMQSQNVQLKVKRG 188
            |.......|:.::......:.:||.::||
Yeast   349 GETISSFMQVDKIQDENVGKEIQLVIQRG 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 16/82 (20%)
NMA111NP_014276.1 DegQ 48..391 CDD:223343 47/224 (21%)
PDZ_1 392..469 CDD:372324
DegQ 543..870 CDD:223343
PDZ <810..862 CDD:412172
PDZ 869..944 CDD:412172
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.