DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and AT5G57950

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001330274.1 Gene:AT5G57950 / 835906 AraportID:AT5G57950 Length:256 Species:Arabidopsis thaliana


Alignment Length:226 Identity:65/226 - (28%)
Similarity:113/226 - (50%) Gaps:18/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTTTKERLERLINAKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTII 68
            |...|.....|::.:..:|.::|...:.|......|:||.|:|:|||||.|||:..||..|:.:.
plant    32 GANLKAETMALMDKRTAMETEMNSIVERLCNPGGPGLSGNLIDSEGFPREDIDIPMVRTERRRLA 96

  Fly    69 CLQNDHKELMNQIQTLLNQYHSEIAT--------TDPE--LVNRASALDLDSDRSPGGANIT--- 120
            .|:::|.|:..:|...:...||...|        :.||  .::.|:...|.:.....|.::|   
plant    97 ELRSEHGEITEKINVNIQILHSVRPTSRASSTKDSGPEETSLSGAAVNSLSASMQTSGFSVTSGP 161

  Fly   121 ---DLAPARAIVVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQ 182
               |:..:....:|:.::..|||...||..||.:|:||::..|:  ..|.::....::.|.|.|.
plant   162 MDVDVVTSIPFAMVDEINESSPAAEGGLQLGDQVLKFGNVEGGD--NLLQRLAAEAQSNQGQAVS 224

  Fly   183 LKVKRGEQQLDLILVPKTWSGRGLLGCNIVL 213
            ::|.|...::.|.:.|:.|.|||||||:..|
plant   225 VQVMRQGAKVVLSVTPRIWQGRGLLGCHFRL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 19/75 (25%)
AT5G57950NP_001330274.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4239
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2106
Inparanoid 1 1.050 99 1.000 Inparanoid score I2193
OMA 1 1.010 - - QHG54093
OrthoDB 1 1.010 - - D1405146at2759
OrthoFinder 1 1.000 - - FOG0004887
OrthoInspector 1 1.000 - - oto3401
orthoMCL 1 0.900 - - OOG6_102356
Panther 1 1.100 - - LDO PTHR12651
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4001
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.