DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and Psmd9

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_080276.2 Gene:Psmd9 / 67151 MGIID:1914401 Length:222 Species:Mus musculus


Alignment Length:211 Identity:85/211 - (40%)
Similarity:128/211 - (60%) Gaps:24/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LERLINAKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHK 75
            ::.|:..|:::||:|..|..:|.:...:||:.||||.||:||.|:|:||||.||..|||||||||
Mouse    23 IQDLMRRKEEIEAEIKANYDVLESQKGIGMNEPLVDCEGYPRADVDLYQVRTARHNIICLQNDHK 87

  Fly    76 ELMNQIQTLLNQYHS--------EIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVN 132
            .||.|::..|:|.|:        ::|....|.:||..|     ..||       :.| :|...||
Mouse    88 ALMKQVEEALHQLHARDKEKQARDMAEAREEAMNRRLA-----SNSP-------VLP-QAFARVN 139

  Fly   133 LVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKV-KRGEQQLDLIL 196
            .:||.|||..|||...|.|:.|||:|:.||: .:..:|.:|::.:.:.:.:.| :|||:. .|.|
Mouse   140 SISPGSPASIAGLQVDDEIVEFGSVNTQNFQ-SVQNVGTVVQHSEGKPLNVTVIRRGEKH-QLRL 202

  Fly   197 VPKTWSGRGLLGCNIV 212
            :|..|:|:|||||||:
Mouse   203 IPTRWAGKGLLGCNII 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 23/70 (33%)
Psmd9NP_080276.2 NADB_Rossmann 64..>151 CDD:304358 40/99 (40%)
PDZ_metalloprotease 128..204 CDD:238489 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839279
Domainoid 1 1.000 91 1.000 Domainoid score I7655
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2106
Inparanoid 1 1.050 149 1.000 Inparanoid score I4368
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54093
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004887
OrthoInspector 1 1.000 - - oto92709
orthoMCL 1 0.900 - - OOG6_102356
Panther 1 1.100 - - LDO PTHR12651
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1021
SonicParanoid 1 1.000 - - X4001
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.