DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and Htra2

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_062726.3 Gene:Htra2 / 64704 MGIID:1928676 Length:458 Species:Mus musculus


Alignment Length:246 Identity:60/246 - (24%)
Similarity:90/246 - (36%) Gaps:79/246 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TKERLERLINAKKQLEAQINRNGQILAAN------DNVGMSGPLVDAE------GFPRNDIDVYQ 59
            |||.|..|...:   .|.: |.|:.:.|.      .|...||.:..|:      |.|:|:::..|
Mouse   236 TKEPLPTLPLGR---SADV-RQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQ 296

  Fly    60 VRLARQTIICLQNDHKELMNQIQTLLNQYHSEIATTDPELVNRASALDLDSDR------------ 112
            ...|    |...|....|:|        ...|:...:...|....:..:.|||            
Mouse   297 TDAA----IDFGNSGGPLVN--------LDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKN 349

  Fly   113 ----SPG------GANITDLAPARAI---------------VVVNLVSPDSPAERAGLCAGDAIL 152
                :.|      |..:..|.|:..|               |:::.|...|||.||||..||.||
Mouse   350 SWFGTSGSQRRYIGVMMLTLTPSILIELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVIL 414

  Fly   153 RFGSINSGNFKGDLAQ----IGELVRNMQSQNVQLKVKRGEQQLDLILVPK 199
            ..|.        .|||    :.|.||. ||| :.::::||.:.|.|.:.|:
Mouse   415 AIGE--------KLAQNAEDVYEAVRT-QSQ-LAVRIRRGSETLTLYVTPE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 27/88 (31%)
Htra2NP_062726.3 DegQ 125..454 CDD:223343 59/243 (24%)
IAP-binding motif. /evidence=ECO:0000250 134..137
Serine protease 166..342 27/121 (22%)
Trypsin_2 182..320 CDD:290102 23/99 (23%)
PDZ_serine_protease 360..452 CDD:238487 31/101 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.