Sequence 1: | NP_650301.1 | Gene: | CG9588 / 41672 | FlyBaseID: | FBgn0038166 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021333811.1 | Gene: | htra3b / 573378 | ZFINID: | ZDB-GENE-110602-1 | Length: | 466 | Species: | Danio rerio |
Alignment Length: | 213 | Identity: | 43/213 - (20%) |
---|---|---|---|
Similarity: | 78/213 - (36%) | Gaps: | 78/213 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 RNGQILAAND------------NVGMS-GPLVDAEGFPRNDIDVYQVRLARQTIICLQND----- 73
Fly 74 --------HKELMN--------QIQTLLNQYHSEIATTDPELVNRASALDLDSDRSPGGANITDL 122
Fly 123 APARAIVVVNLVSPDSPAERAGLCAGDAILRFGS---INSGNFKGDLAQIGELVRNMQSQNVQLK 184
Fly 185 VKRGEQQL------DLIL 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9588 | NP_650301.1 | PDZ | 116..186 | CDD:238080 | 14/72 (19%) |
htra3b | XP_021333811.1 | IGFBP | 24..75 | CDD:306685 | |
KAZAL | 87..133 | CDD:197624 | |||
DegQ | 152..>438 | CDD:333159 | 34/175 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0265 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |