DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and PSMD9

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_002804.2 Gene:PSMD9 / 5715 HGNCID:9567 Length:223 Species:Homo sapiens


Alignment Length:219 Identity:91/219 - (41%)
Similarity:131/219 - (59%) Gaps:23/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AGTTTKERLERLINAKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTI 67
            ||..|...::.|:..|:::||||..|..:|.:...:||:.||||.||:||:|:|:||||.||..|
Human    15 AGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNI 79

  Fly    68 ICLQNDHKELMNQIQTLLNQYHS--------EIATTDPELVNRASALDLDSDRSPGGANITDLAP 124
            ||||||||.:|.|::..|:|.|:        ::|....|.::|    .|....|.|        |
Human    80 ICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSR----KLGQSESQG--------P 132

  Fly   125 ARAIVVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKV-KRG 188
            .||...||.:||.|||..|||...|.|:.|||:|:.||: .|..||.:|::.:.:.:.:.| :||
Human   133 PRAFAKVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQ-SLHNIGSVVQHSEGKPLNVTVIRRG 196

  Fly   189 EQQLDLILVPKTWSGRGLLGCNIV 212
            |:. .|.|||..|:|:|||||||:
Human   197 EKH-QLRLVPTRWAGKGLLGCNII 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 26/70 (37%)
PSMD9NP_002804.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..141 10/49 (20%)
PDZ_metalloprotease 129..205 CDD:238489 33/85 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149216
Domainoid 1 1.000 93 1.000 Domainoid score I7578
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2106
Inparanoid 1 1.050 161 1.000 Inparanoid score I4242
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54093
OrthoDB 1 1.010 - - D1405146at2759
OrthoFinder 1 1.000 - - FOG0004887
OrthoInspector 1 1.000 - - oto89143
orthoMCL 1 0.900 - - OOG6_102356
Panther 1 1.100 - - LDO PTHR12651
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1021
SonicParanoid 1 1.000 - - X4001
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.