DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and HTRA1

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_002766.1 Gene:HTRA1 / 5654 HGNCID:9476 Length:480 Species:Homo sapiens


Alignment Length:174 Identity:37/174 - (21%)
Similarity:72/174 - (41%) Gaps:32/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NVGMS-GPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELMNQIQTLLNQYHSEIATTDPELV 100
            |.|.| ||||:.:|   ..|.:..:::.......:.:|      :|:..|.:.|...|.......
Human   324 NYGNSGGPLVNLDG---EVIGINTLKVTAGISFAIPSD------KIKKFLTESHDRQAKGKAITK 379

  Fly   101 NRASALDLDSDRSPGGANITD--------LAPARAIVVVNLVSPDSPAERAGLCAGDAILRFG-- 155
            .:...:.:.|..|.....:.|        ::.|..|.|:    ||:|||..||...|.|:...  
Human   380 KKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVI----PDTPAEAGGLKENDVIISINGQ 440

  Fly   156 SINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPK 199
            |:.|.|      .:.::::...:.|  :.|:||.:.:.:.::|:
Human   441 SVVSAN------DVSDVIKRESTLN--MVVRRGNEDIMITVIPE 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 17/79 (22%)
HTRA1NP_002766.1 IB 35..111 CDD:197525
KAZAL 115..155 CDD:197624
DegQ 154..480 CDD:223343 37/174 (21%)
Serine protease 204..364 11/48 (23%)
Trypsin_2 204..342 CDD:290102 9/20 (45%)
PDZ_serine_protease 382..473 CDD:238487 22/102 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.