DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and psmd9

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001016559.1 Gene:psmd9 / 549313 XenbaseID:XB-GENE-5727784 Length:211 Species:Xenopus tropicalis


Alignment Length:206 Identity:82/206 - (39%)
Similarity:118/206 - (57%) Gaps:11/206 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TKERLERLINAKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQ 71
            |...:|.||:.|.::||||.....:|.....|||..||||.||:||.|:|:||||.||..|||||
 Frog    13 TMHDVELLISKKDEIEAQIKALYDLLQDQKAVGMDEPLVDREGYPRADVDIYQVRTARHNIICLQ 77

  Fly    72 NDHKELMNQIQTLLNQYHSEIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSP 136
            ||||.:|.:|:..|::.|:.......:....|.|..|.|.:          |...|...|::|:|
 Frog    78 NDHKAIMKEIEESLHRLHAREKEKREKDEAEAQAEALQSHQ----------ALPTAFAKVDVVTP 132

  Fly   137 DSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPKTW 201
            .|||..:||..||.|:.||::|:.||: .|..|.|:|::.:.:.:.:.|.|..:.:...|.|..|
 Frog   133 GSPASMSGLQVGDEIISFGTVNTSNFQ-SLQNIAEVVQHSEGKPLSVSVVRNGKLVSFALTPLRW 196

  Fly   202 SGRGLLGCNIV 212
            ||:|||||||:
 Frog   197 SGKGLLGCNII 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 22/69 (32%)
psmd9NP_001016559.1 Nas2_N 20..96 CDD:375692 39/75 (52%)
PDZ_metalloprotease 121..193 CDD:238489 24/72 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8215
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2106
Inparanoid 1 1.050 144 1.000 Inparanoid score I4340
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1405146at2759
OrthoFinder 1 1.000 - - FOG0004887
OrthoInspector 1 1.000 - - oto102995
Panther 1 1.100 - - LDO PTHR12651
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4001
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.160

Return to query results.
Submit another query.