DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and htra1a

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001002219.1 Gene:htra1a / 431766 ZFINID:ZDB-GENE-040704-64 Length:479 Species:Danio rerio


Alignment Length:183 Identity:35/183 - (19%)
Similarity:70/183 - (38%) Gaps:52/183 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NVGMS-GPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELMNQIQTLLNQYHSEIA----TTD 96
            |.|.| ||||:.:|   ..|.:..:::.......:.:|      :|:..|.:.:..:|    ||.
Zfish   323 NYGNSGGPLVNLDG---EVIGINTLKVTAGISFAIPSD------KIRQFLAESYDRLARGRGTTK 378

  Fly    97 PELVNRASALDLDSDRSPGGANITDLAPA----------------RAIVVVNLVSPDSPAERAGL 145
            ...:               |..:..|.|:                ....|:.::| .:||...||
Zfish   379 KRYI---------------GVRMMTLTPSLSKELKGRLRDFPDITSGAYVIEVIS-KTPAAAGGL 427

  Fly   146 CAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVP 198
            ...|.|:   ||| |........:..:::  :..::::.|:||.:.:.|.::|
Zfish   428 KEHDVII---SIN-GQRISTATDVSAIIK--KESSLRVVVRRGNEDIILTIIP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 15/85 (18%)
htra1aNP_001002219.1 IGFBP 31..87 CDD:278641
KAZAL_FS 111..153 CDD:238052
DegQ 160..479 CDD:223343 35/183 (19%)
Serine protease 203..363 11/48 (23%)
Trypsin_2 203..341 CDD:290102 9/20 (45%)
PDZ_serine_protease 380..472 CDD:238487 19/113 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.