DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and CG3589

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster


Alignment Length:202 Identity:50/202 - (24%)
Similarity:81/202 - (40%) Gaps:53/202 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELMNQI 81
            |.||  :.|..|.:::.::.::......||.:...:|...|  .||.|..::.:||:.:|...||
  Fly    17 AAKQ--SAIIINNELIISSGSILQPHLAVDGDKGAQNKAIV--ARLQRGQLLDVQNEEQEEDAQI 77

  Fly    82 QTLLNQYHSEIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVV--VN---------LVS 135
            ::|    |. :||.||: ..|...:.....|.|   :|.....|..:.|  .|         |::
  Fly    78 RSL----HF-VATFDPQ-QRRPRPIAAPGSRQP---HILSRFTAHPLYVFCANEVCRNLHHILLT 133

  Fly   136 PDSPAERAGLCAGDA--ILRFGSINSG--------NFKGDLAQIGELVRNMQSQNVQLKVKRGEQ 190
            .||         |||  :||...:..|        :||..||.|...:|.:|..:.         
  Fly   134 ADS---------GDAGEVLRSSFVVLGLRKPEKEKSFKRFLAHIANYLRYLQPMHT--------- 180

  Fly   191 QLDLILV 197
             ||.:||
  Fly   181 -LDDVLV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 20/90 (22%)
CG3589NP_611968.1 Trypsin 296..471 CDD:278516
Trypsin_2 305..445 CDD:290102
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.