DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and Htra3

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001257956.1 Gene:Htra3 / 360959 RGDID:1308120 Length:459 Species:Rattus norvegicus


Alignment Length:199 Identity:45/199 - (22%)
Similarity:79/199 - (39%) Gaps:53/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RNGQILAAND------------NVGMS-GPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELM 78
            |:|:.|...|            |.|.| ||||:.:|   ..|.:..:::|......:.:|     
  Rat   285 RDGKELGLRDSDMDYIQTDAIINYGNSGGPLVNLDG---EVIGINTLKVAAGISFAIPSD----- 341

  Fly    79 NQIQTLLNQYHSE-------------IATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVV 130
             :|...|:::..:             :.|..|.||......:.|......|            :.
  Rat   342 -RITRFLSEFQDKHVKDWKKRFIGIRMRTITPSLVEELKTANPDFPAVSSG------------IY 393

  Fly   131 VNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLI 195
            |..|.|:||::|.|:..||.|::.    :|....|.:::.|.|.|..|  :.|:|:||...|...
  Rat   394 VQEVVPNSPSQRGGIQDGDIIVKV----NGRPLVDSSELQEAVLNESS--LLLEVRRGNDDLLFS 452

  Fly   196 LVPK 199
            ::|:
  Rat   453 IMPE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 18/69 (26%)
Htra3NP_001257956.1 IGFBP 31..82 CDD:278641
Kazal_2 87..132 CDD:284958
Serine protease. /evidence=ECO:0000250 181..346 16/69 (23%)
Trypsin_2 181..325 CDD:290102 13/42 (31%)
PDZ_serine_protease 361..446 CDD:238487 25/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.