Sequence 1: | NP_650301.1 | Gene: | CG9588 / 41672 | FlyBaseID: | FBgn0038166 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001257956.1 | Gene: | Htra3 / 360959 | RGDID: | 1308120 | Length: | 459 | Species: | Rattus norvegicus |
Alignment Length: | 199 | Identity: | 45/199 - (22%) |
---|---|---|---|
Similarity: | 79/199 - (39%) | Gaps: | 53/199 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 RNGQILAAND------------NVGMS-GPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELM 78
Fly 79 NQIQTLLNQYHSE-------------IATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVV 130
Fly 131 VNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLI 195
Fly 196 LVPK 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9588 | NP_650301.1 | PDZ | 116..186 | CDD:238080 | 18/69 (26%) |
Htra3 | NP_001257956.1 | IGFBP | 31..82 | CDD:278641 | |
Kazal_2 | 87..132 | CDD:284958 | |||
Serine protease. /evidence=ECO:0000250 | 181..346 | 16/69 (23%) | |||
Trypsin_2 | 181..325 | CDD:290102 | 13/42 (31%) | ||
PDZ_serine_protease | 361..446 | CDD:238487 | 25/102 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0265 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |