Sequence 1: | NP_650301.1 | Gene: | CG9588 / 41672 | FlyBaseID: | FBgn0038166 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036010000.1 | Gene: | Htra4 / 330723 | MGIID: | 3036260 | Length: | 499 | Species: | Mus musculus |
Alignment Length: | 236 | Identity: | 54/236 - (22%) |
---|---|---|---|
Similarity: | 79/236 - (33%) | Gaps: | 88/236 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAAG-TTTKERLERLINAKK------QLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVY 58
Fly 59 QVRLARQTI---ICLQNDHKELMNQIQTLLNQYH---------------------------SEIA 93
Fly 94 TTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSPAERAGLCAGDAILRFGSIN 158
Fly 159 SGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPK 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9588 | NP_650301.1 | PDZ | 116..186 | CDD:238080 | 15/69 (22%) |
Htra4 | XP_036010000.1 | IGFBP | 85..139 | CDD:395164 | |
Kazal_2 | 156..204 | CDD:400135 | |||
degP_htrA_DO | 222..>494 | CDD:273938 | 53/232 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0265 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |