DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and Htra4

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_036010000.1 Gene:Htra4 / 330723 MGIID:3036260 Length:499 Species:Mus musculus


Alignment Length:236 Identity:54/236 - (22%)
Similarity:79/236 - (33%) Gaps:88/236 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAG-TTTKERLERLINAKK------QLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVY 58
            :.|| .:|.:|..|.:..|.      |.:|.||        :.|.|  ||||:.:|      ||.
Mouse   312 VTAGIVSTTQRGGRELGLKNSDIDYIQTDAIIN--------HGNSG--GPLVNLDG------DVI 360

  Fly    59 QVRLARQTI---ICLQNDHKELMNQIQTLLNQYH---------------------------SEIA 93
            .:...:.|.   ..:.:|      :|:..|..||                           .|:.
Mouse   361 GINTLKVTAGISFAIPSD------RIRQFLEDYHERQLKGKAPLQKKYLGLRMLPLTLNLLQEMK 419

  Fly    94 TTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSPAERAGLCAGDAILRFGSIN 158
            ..|||.          .|.|.|             |.|..|...|.|..:||...|.|:   |||
Mouse   420 RQDPEF----------PDVSSG-------------VFVYEVIQGSAAASSGLRDHDVIV---SIN 458

  Fly   159 SGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPK 199
             |........:.|.|::  :..:.:.|.||.|.|.|.:.|:
Mouse   459 -GQPVTTTTDVIEAVKD--NDFLSIIVLRGSQTLFLTVTPE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 15/69 (22%)
Htra4XP_036010000.1 IGFBP 85..139 CDD:395164
Kazal_2 156..204 CDD:400135
degP_htrA_DO 222..>494 CDD:273938 53/232 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.