DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and Htra2

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001100069.1 Gene:Htra2 / 297376 RGDID:1308906 Length:458 Species:Rattus norvegicus


Alignment Length:178 Identity:45/178 - (25%)
Similarity:77/178 - (43%) Gaps:32/178 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDH-KELMNQ---------IQTLLNQ 87
            ||.|.....||||:.:|   ..|.|..:::.......:.:|. :|.:::         |.....:
  Rat   299 AAIDFGNSGGPLVNLDG---EVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGISGSQRR 360

  Fly    88 YHS-EIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSPAERAGLCAGDAI 151
            |.. .:.|..|.::   :.|.|   |.|...::      :..|:::.|...|||.||||...|.|
  Rat   361 YIGVMMLTLTPSIL---AELQL---REPSFPDV------QHGVLIHKVILGSPAHRAGLRPADVI 413

  Fly   152 LRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPK 199
            |..|.....|.:    .:.|.||. ||| :.::::||.:.|.|.:.|:
  Rat   414 LAIGEKMIQNAE----DVYEAVRT-QSQ-LAVRIRRGPETLTLYVTPE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 20/69 (29%)
Htra2NP_001100069.1 DegQ 140..454 CDD:223343 44/175 (25%)
Trypsin_2 182..320 CDD:290102 9/23 (39%)
PDZ_serine_protease 360..452 CDD:238487 31/109 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.