DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and HTRA4

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_710159.1 Gene:HTRA4 / 203100 HGNCID:26909 Length:476 Species:Homo sapiens


Alignment Length:212 Identity:46/212 - (21%)
Similarity:87/212 - (41%) Gaps:50/212 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TTKERLERLINAKK------QLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLAR 64
            :||:|..:.:..|.      |::|.||..        |.|  ||||:.:|   :.|.|..:|:..
Human   296 STKQRGGKELGMKDSDMDYVQIDATINYG--------NSG--GPLVNLDG---DVIGVNSLRVTD 347

  Fly    65 QTIICLQNDHKELMNQIQTLLNQYHSEIATTDPELVNRASA------LDLDSDRSPGGANI---- 119
            .....:.:|      :::..|.:||      :.::..:|.:      |.:.|...|....:    
Human   348 GISFAIPSD------RVRQFLAEYH------EHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHY 400

  Fly   120 TDLAPARAIVVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKG-DLAQIGELVRNMQSQNVQL 183
            .|.....:.|.|..|...:.|:.:||...|.|:        |..| .:....::|:.:.|.::.:
Human   401 PDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIV--------NINGKPITTTTDVVKALDSDSLSM 457

  Fly   184 KVKRGEQQLDLILVPKT 200
            .|.||:..|.|.::|:|
Human   458 AVLRGKDNLLLTVIPET 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 13/74 (18%)
HTRA4NP_710159.1 IGFBP 40..94 CDD:278641
Kazal_2 108..152 CDD:284958
DegQ 156..470 CDD:223343 44/206 (21%)
Serine protease 202..362 19/84 (23%)
Trypsin_2 202..340 CDD:290102 16/56 (29%)
PDZ_serine_protease 380..470 CDD:238487 21/97 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.