DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and Psmd9

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_569114.2 Gene:Psmd9 / 161475 RGDID:621110 Length:222 Species:Rattus norvegicus


Alignment Length:211 Identity:89/211 - (42%)
Similarity:127/211 - (60%) Gaps:26/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LERLINAKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHK 75
            ::.|:..|:::||||..|..:|.:...:||:.||||.||:||.|:|:||||.||..|||||||||
  Rat    23 IQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRADVDLYQVRTARHNIICLQNDHK 87

  Fly    76 ELMNQIQTLLNQYHS--------EIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVN 132
            .||.|::..|:|.|:        ::|....|.:||..|.|     ||        |..:|...||
  Rat    88 ALMKQVEEALHQLHARDKEKQARDMAEAREEAMNRRLASD-----SP--------ALPKAFARVN 139

  Fly   133 LVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQ--NVQLKVKRGEQQLDLI 195
            .:||.|||..|||...|.|:.|||:|:.||: .|..:|.:|::.:.:  ||.: ::|||:. .|.
  Rat   140 SISPGSPASIAGLQVDDEIVEFGSVNTQNFQ-SLQNVGSVVQHSEGKPLNVMV-IRRGEKH-QLR 201

  Fly   196 LVPKTWSGRGLLGCNI 211
            |.|..|:|:|||||||
  Rat   202 LTPTRWAGKGLLGCNI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 25/71 (35%)
Psmd9NP_569114.2 Nas2_N 23..102 CDD:408080 40/78 (51%)
PDZ_metalloprotease 132..204 CDD:238489 29/74 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343090
Domainoid 1 1.000 94 1.000 Domainoid score I7326
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2106
Inparanoid 1 1.050 153 1.000 Inparanoid score I4255
OMA 1 1.010 - - QHG54093
OrthoDB 1 1.010 - - D1405146at2759
OrthoFinder 1 1.000 - - FOG0004887
OrthoInspector 1 1.000 - - oto96272
orthoMCL 1 0.900 - - OOG6_102356
Panther 1 1.100 - - LDO PTHR12651
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4001
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.