DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and si:dkey-84o3.2

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_005161042.1 Gene:si:dkey-84o3.2 / 100330919 ZFINID:ZDB-GENE-091113-19 Length:209 Species:Danio rerio


Alignment Length:139 Identity:26/139 - (18%)
Similarity:44/139 - (31%) Gaps:49/139 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELMNQ-----------------------IQT 83
            |||::.:|   ..|.:..:::.......:.:|...|..:                       :.|
Zfish    49 GPLINLDG---EVIGINTMKVTAGISFAIPSDRVRLFLERSADKQKSWFGESGWKRRYIGVMMLT 110

  Fly    84 LLNQYHSEIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSPAERAGLCAG 148
            |......|:...||..          .|.|.|             |:::.|...|||.|||:..|
Zfish   111 LTPSIIEELRMRDPSF----------PDVSHG-------------VLIHRVIVGSPANRAGMKPG 152

  Fly   149 DAILRFGSI 157
            |.|:....:
Zfish   153 DVIIEINGV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 11/42 (26%)
si:dkey-84o3.2XP_005161042.1 Trypsin_2 <4..61 CDD:290102 5/14 (36%)
PDZ_serine_protease 102..>179 CDD:238487 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.