DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCNK17

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_113648.2 Gene:KCNK17 / 89822 HGNCID:14465 Length:332 Species:Homo sapiens


Alignment Length:266 Identity:79/266 - (29%)
Similarity:133/266 - (50%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TISLIVCTFTYLLVGAAVFDALESET--------EKRRWEALQD-------AEDMIIRKYNISQE 57
            |:.|::....||.:|..||..||...        ::.:||.||:       |.|.:||  ::.|.
Human    22 TVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKWELLQNFTCLDRPALDSLIR--DVVQA 84

  Fly    58 DFKVMETVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGL 122
             :|  ....|.|.:...| :|:..|:|:::.:.:||||||:.:|:|:..:||.:.:|:|||||.|
Human    85 -YK--NGASLLSNTTSMG-RWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVGIPLNL 145

  Fly   123 VMFQSIG----ERVNRLSSYVIKAVRSSLRCKRTVASEVDL--ICVVTTLSSLTIAGGAAAFSKF 181
            |:...:|    :.||..:|.:....:...:.:....|...|  :.:...|..|       .||..
Human   146 VVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPL-------LFSHM 203

  Fly   182 EGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMF----ALIFILFGLAIVAASLNLL 242
            |||||.:..|:.||||:|:||||.|.     .:|....|.::    ..::||||:|.:|..:.|:
Human   204 EGWSYTEGFYFAFITLSTVGFGDYVI-----GMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLI 263

  Fly   243 VLRFVT 248
            :.:..|
Human   264 LSQLET 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 22/58 (38%)
Ion_trans_2 169..247 CDD:285168 28/81 (35%)
KCNK17NP_113648.2 Ion_trans_2 96..157 CDD:285168 23/61 (38%)
Ion_trans_2 <203..268 CDD:285168 25/69 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.