DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and CG42594

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster


Alignment Length:476 Identity:101/476 - (21%)
Similarity:164/476 - (34%) Gaps:191/476 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KRRWEALQDAE-----DMIIRKYN------ISQEDF----------------------------- 59
            |..|..|...|     |.:|::.|      :|.:|.                             
  Fly   501 KENWTKLAALEIAKFQDQLIKRLNEDVMLQLSHDDVANAPSSSSSSSSSSSSSSSSTGASGVPGS 565

  Fly    60 --KVMETVVLKS--ESHKAG------------QQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKL 108
              ...|.|:|.:  ..|:||            .:|.|..||.|:.|||||||||:..|.|..|::
  Fly   566 NNPATEAVLLHTHYHHHRAGGVGGVAVGGGPPHEWNFAKAFLYSLTVLTTIGYGNVAPRTTLGRI 630

  Fly   109 FTMCYAIVGIPLGLVMFQSIGERVNRLSSYVI-------------------------------KA 142
            .|:.||..||||.||...|.|..:.|::..|.                               |.
  Fly   631 VTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKR 695

  Fly   143 VRSSLRCKRTVASE-------------------------------------VD------------ 158
            .:..||.::.|..|                                     :|            
  Fly   696 QQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMH 760

  Fly   159 --------LICVVTTLSSLTIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMV-ALQRD-NA 213
                    |:|.  ::..:.|..|||...:.|.|...|.:|:||::|:|||||||: .|:|: ||
  Fly   761 GLSILAPILLCF--SMMIIYIVFGAAVLYRLEKWPILDGIYFCFMSLSTIGFGDMLPGLRRESNA 823

  Fly   214 LNRKPEYVMFALIFILFGLAIVAASLNLL---VLRFVTMNTEDERRDEAQAMQALQVAVKLEGDV 275
            .      ..|..::|:.|:.:.|...|::   ::..:.:..|.::...|.:           |..
  Fly   824 T------TWFCSVYIMSGMTLTAMCFNVIHEEIVHRIRIVVEFKKTSAANS-----------GGG 871

  Fly   276 ITSNGSILSGYEGHDGQSLN-----GSNTSSMCSCHCICLNGNRHKKSSNLEKNNDAENQYKLRQ 335
            :...||:..|..|..|..::     |.......|.|        ::|..:|.:.|..| :..:..
  Fly   872 LIGGGSVSGGAGGAGGSMMDVAHEEGGQYYVPASXH--------YEKRGHLYQRNPTE-ETLVTD 927

  Fly   336 SPT------HIRHLLPEVVPM 350
            :||      ::.|   |:||:
  Fly   928 TPTSLVLKDYVNH---ELVPI 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 28/54 (52%)
Ion_trans_2 169..247 CDD:285168 27/82 (33%)
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:285168 28/56 (50%)
Ion_trans <601..640 CDD:278921 19/38 (50%)
Ion_trans_2 774..846 CDD:285168 27/77 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461300
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.