DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCNK5

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_003731.1 Gene:KCNK5 / 8645 HGNCID:6280 Length:499 Species:Homo sapiens


Alignment Length:294 Identity:87/294 - (29%)
Similarity:140/294 - (47%) Gaps:43/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYN-ISQEDF-KVMETVVLKSESHKAGQ---- 76
            ||.:|||:|:.||....|...:.....:..:::::. :.||.. |::|.|     |..|||    
Human    15 YLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVV-----SDAAGQGVAI 74

  Fly    77 -------QWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGE---- 130
                   .|.:..|..:|.||:||||||:..|.|..|:||.:.|.:.|:||.|....::|:    
Human    75 TGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFGG 139

  Fly   131 RVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVT-----TLSSLTIAGGAAAFSKFEGWSYFDSV 190
            |..||..::.|. ..|||       :..:.|.|.     .|..|.|.  ...|...|||:|.:.:
Human   140 RAKRLGQFLTKR-GVSLR-------KAQITCTVIFIVWGVLVHLVIP--PFVFMVTEGWNYIEGL 194

  Fly   191 YYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLLVLRFVTMN----- 250
            ||.|||::||||||.||....:| |....|..|..::|..|||.::..:|..|..||.::     
Human   195 YYSFITISTIGFGDFVAGVNPSA-NYHALYRYFVELWIYLGLAWLSLFVNWKVSMFVEVHKAIKK 258

  Fly   251 TEDERRDEAQAMQALQVAVKLEGDVITSNGSILS 284
            ....|::..::....:.|::::|...:.:.:|.|
Human   259 RRRRRKESFESSPHSRKALQVKGSTASKDVNIFS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 22/58 (38%)
Ion_trans_2 169..247 CDD:285168 30/77 (39%)
KCNK5NP_003731.1 Ion_trans_2 <81..137 CDD:311712 22/55 (40%)
Ion_trans_2 171..243 CDD:311712 29/74 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..388
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..499
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.