DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcns3

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_113966.2 Gene:Kcns3 / 83588 RGDID:621527 Length:491 Species:Rattus norvegicus


Alignment Length:158 Identity:36/158 - (22%)
Similarity:55/158 - (34%) Gaps:58/158 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DALESETEKRRWEALQDAEDM-----IIRKYNISQEDFKVMET-----------VVLKSESHKAG 75
            |..|.|:|        |.|:|     |:|...|    |::::.           ..|:...|:.|
  Rat   273 DTKEEESE--------DIENMGKVVQILRLMRI----FRILKLARHSVGLRSLGATLRHSYHEVG 325

  Fly    76 QQWKFTG---------------------------AFYYATTVLTTIGYGHSTPSTVGGKLFTMCY 113
            ....|..                           .:::||..:||:|||.:.|.|:.||:.....
  Rat   326 LLLLFLSVGISIFSVLIYSVEKDELASSLTSIPICWWWATISMTTVGYGDTHPVTLAGKIIASTC 390

  Fly   114 AIVGIPLGLVMFQSIGERVNRLSSYVIK 141
            .|.||   ||:...|....|:.|.|..|
  Rat   391 IICGI---LVVALPITIIFNKFSKYYQK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 18/80 (23%)
Ion_trans_2 165..243 CDD:462301
Kcns3NP_113966.2 BTB_POZ_KCNS3 15..122 CDD:349735
Ion_trans 184..417 CDD:459842 36/158 (23%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 370..375 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.