DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCO1

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_200374.1 Gene:KCO1 / 835657 AraportID:AT5G55630 Length:363 Species:Arabidopsis thaliana


Alignment Length:189 Identity:45/189 - (23%)
Similarity:80/189 - (42%) Gaps:34/189 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 AFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSYVIK-----A 142
            |.|:....:||:|||...|::...:|....:...|:.|       :|..::|.:.|:::     .
plant   112 ALYFCIVTMTTVGYGDLVPNSSASRLLACAFVFSGMVL-------VGHLLSRAADYLVEKQEALL 169

  Fly   143 VRS-SLR--------CKRTVASEVDLICVVTTLSSLTIAGGAAAFSKFEGWSYFDSVYYCFI-TL 197
            ||: .||        .|....:::...|..|.|..:.:......|..........|.:||.. |:
plant   170 VRAFHLRQSFGPTDILKELHTNKLRYKCYATCLVLVVLFIVGTIFLVMVEKMPVISAFYCVCSTV 234

  Fly   198 TTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLLVLRFVTMNTEDERR 256
            ||:|:|       |.:.|.:... :||:.:||.. :|..|...|.|   ..:|||:::|
plant   235 TTLGYG-------DKSFNSEAGR-LFAVFWILTS-SICLAQFFLYV---AELNTENKQR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 12/48 (25%)
Ion_trans_2 169..247 CDD:285168 19/78 (24%)
KCO1NP_200374.1 Ion_trans_2 81..163 CDD:400301 14/57 (25%)
Ion_trans_2 202..277 CDD:400301 21/86 (24%)
FRQ1 <235..353 CDD:227455 18/59 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.