DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCO2

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_199449.1 Gene:KCO2 / 834680 AraportID:AT5G46370 Length:443 Species:Arabidopsis thaliana


Alignment Length:244 Identity:58/244 - (23%)
Similarity:107/244 - (43%) Gaps:52/244 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPL------GLVMF 125
            |..:|:...|......|.|:....:.|||||..||.:|..|||::.:.:||...      |:|.:
plant   166 LNRDSYNVKQTHPVVDALYFCIVTMCTIGYGDITPDSVVTKLFSIFFVLVGFGFMDILLSGMVTY 230

  Fly   126 -----------------QSIGERVNRLSSYVI--KAVRSSLRCKRTVASEVDLICVVTTLSSLTI 171
                             .::.:| :::.||:|  |..|..:|.|..:|..|.::|         :
plant   231 VLDLQENYMLETARNESLNLNDR-DKVRSYIIDVKKGRMRIRLKVGLALGVVVLC---------L 285

  Fly   172 AGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVA 236
            ..|.......|...:.||.|:..:::||:|:|       |.|.|.....::.|:..::..||:..
plant   286 GFGVLIMHFVEKIGWLDSFYFSVMSVTTVGYG-------DRAFNTLAGRLLAAMWLLVSTLAVAR 343

  Fly   237 ASLNLLVLRFVTMNTEDER-RDEAQAM--QALQVAVKLEGDVITSNGSI 282
            |.|      |:..:..|:| |:.|:.:  :::.::..|:.| |..||.:
plant   344 AIL------FLAESRVDKRNRERAKKVLGESMSISQFLDAD-IDCNGCV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 17/77 (22%)
Ion_trans_2 169..247 CDD:285168 17/77 (22%)
KCO2NP_199449.1 Ion_trans_2 152..233 CDD:400301 20/66 (30%)
Ion_trans_2 280..350 CDD:400301 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.