DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCO5

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_192093.1 Gene:KCO5 / 828091 AraportID:AT4G01840 Length:408 Species:Arabidopsis thaliana


Alignment Length:247 Identity:54/247 - (21%)
Similarity:93/247 - (37%) Gaps:65/247 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 YNISQEDFKVMETVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIV 116
            |:.:::.:..:||       |..      ..|.|:....:.|||||...|.|...|:|.:.:.:.
plant   135 YSFNRDHYSGIET-------HPV------VDALYFCIVTMCTIGYGDIAPLTPWTKIFAVVFVLF 186

  Fly   117 GIPLGLVMFQSIGERV-----------------------NRLSS--YVIKAVRSSLRCKRTVASE 156
            |.....::...:...|                       :|.|:  |:|...:..:|.:..|.. 
plant   187 GFGFLDILLSGVVNYVLDLQESMILTGIQTRQHHQHHHHHRFSAKDYIIDFEKGRMRIRMKVCL- 250

  Fly   157 VDLICVVTTLSSLTIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYV 221
              .:|||.    |.|..||......|...:.||||...:::||:|:||.........|       
plant   251 --ALCVVV----LCIGVGALVLHFVEELGFVDSVYLSVMSVTTVGYGDRAFKTLQGRL------- 302

  Fly   222 MFALIFILFG-LAIVAASLNLLVLRFVTMNTEDERRDEAQAMQALQVAVKLE 272
             ||.:::|.. ||:..|.|.|.           |.|.:.:..:|:::|:..|
plant   303 -FAAVWLLVSTLAVARAFLYLA-----------EARIDRRHRKAVKLALNRE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 12/54 (22%)
Ion_trans_2 169..247 CDD:285168 23/78 (29%)
KCO5NP_192093.1 Ion_trans_2 122..204 CDD:285168 17/81 (21%)
Ion_trans_2 254..325 CDD:285168 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.