DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCO6

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_193550.1 Gene:KCO6 / 827541 AraportID:AT4G18160 Length:436 Species:Arabidopsis thaliana


Alignment Length:236 Identity:60/236 - (25%)
Similarity:95/236 - (40%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPL------GLV-- 123
            |..:.:...|........|:....:.|||||..||::|..|||::.:.:||...      |:|  
plant   170 LNRDHYVVNQTHPVVDGLYFCIVTMCTIGYGDITPNSVVTKLFSIMFVLVGFGFIDILLSGMVSY 234

  Fly   124 --------MFQSIGER--VNRLSSYVI--KAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGGAA 176
                    |..|...|  ..:..||:|  |..|..:|.|..:|..|.::|:       .:..|..
plant   235 VLDLQESYMLDSAKRRDEPEKRRSYIIDVKKGRMRIRLKVALALGVVVLCI-------AVGVGIM 292

  Fly   177 AFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNL 241
            .|.:..||  .||.|...:::||:|:|       |.|....|..:..|:..::..||:..|.|.|
plant   293 HFIEEIGW--LDSFYLSVMSVTTVGYG-------DRAFKTLPGRLFAAIWLLVSTLAVARAFLYL 348

  Fly   242 LVLRFVTMNTEDERRDEAQAMQALQVAVKLEGDVITSNGSI 282
            ...|....|.|..::...:.|...|.   ...| |.:||.:
plant   349 AEARVDKRNRERAKKVLCETMSVSQF---FAAD-IDNNGCV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 19/72 (26%)
Ion_trans_2 169..247 CDD:285168 21/77 (27%)
KCO6NP_193550.1 Ion_trans_2 156..237 CDD:400301 18/66 (27%)
Ion_trans_2 280..351 CDD:400301 22/86 (26%)
EF-hand_7 374..431 CDD:404394 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3728
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.