DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and si:ch73-334d15.4

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001429287.1 Gene:si:ch73-334d15.4 / 796217 ZFINID:ZDB-GENE-091204-184 Length:430 Species:Danio rerio


Alignment Length:132 Identity:29/132 - (21%)
Similarity:58/132 - (43%) Gaps:25/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RVNRLSSYV--IKAVRSSLRCKRTVASEVDLICVVTTLSSL-TIAGGAAAF--------SKFEGW 184
            ||.:|..:|  ::.:..:||...|      .:|:|..|.|: |:..|...:        |.....
Zfish   288 RVFKLMQHVFGVRVLTHTLRASLT------SLCIVPLLLSICTLIFGTMFYFAELTHKDSYISSS 346

  Fly   185 SYFDSVYYCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNLLVLRFVTM 249
            |..|..::..:||||:|:|||:.:.|...        ..|.:..:.|:.::...:.::|..|:..
Zfish   347 SGLDGFWWALVTLTTVGYGDMLPVTRQGK--------CVAFLCAMVGVLLIVLPVPIIVNNFLKF 403

  Fly   250 NT 251
            ::
Zfish   404 SS 405

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity