DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcna6a

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001124098.1 Gene:kcna6a / 795490 ZFINID:ZDB-GENE-080722-21 Length:475 Species:Danio rerio


Alignment Length:121 Identity:25/121 - (20%)
Similarity:50/121 - (41%) Gaps:48/121 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDA----LESETEKRRWEALQDAEDMIIRKYNISQEDFKVME 63
            :.::|.:.|::   .:|::|..:|.:    .|::..:..:.::.|                    
Zfish   312 RASMRELGLLI---FFLIIGIILFSSAVYFAEADDPETSFTSIPD-------------------- 353

  Fly    64 TVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLF-TMCYAIVGI 118
                               ||::|...:||:|||...|.|:|||:. :|| ||.|:
Zfish   354 -------------------AFWWAVVSMTTVGYGDMYPVTIGGKIVGSMC-AIAGV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 18/42 (43%)
Ion_trans_2 165..243 CDD:462301
kcna6aNP_001124098.1 BTB_POZ 31..157 CDD:453885
Ion_trans 203..411 CDD:459842 25/121 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.