DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk1a

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001092223.1 Gene:kcnk1a / 793480 ZFINID:ZDB-GENE-070620-26 Length:338 Species:Danio rerio


Alignment Length:332 Identity:88/332 - (26%)
Similarity:143/332 - (43%) Gaps:81/332 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRK----YNISQEDF--KVME-----T 64
            |::....||:.||.||.|:|...|::..:.|:..:...:..    .|...|:|  |.:|     .
Zfish    26 LVLAYVLYLIFGALVFSAVELPYEEQLRQELRTVKQQFLEDNECLSNDRLEEFLIKALEASNYGV 90

  Fly    65 VVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIG 129
            .||.:.|  :...|.||.|.::|:|||:|.||||:.|.:.|||.|.:.|::||||..|:...::.
Zfish    91 SVLNNAS--SNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVVGIPFTLLFLTAVV 153

  Fly   130 ERVNRLSSYVIKAVRSSLRCKRTV---------------ASEVDLICVVTTLSSLTIAGGAAAFS 179
            :|:...|:            :|.:               |....|:.::|......|.  |..||
Zfish   154 QRIMEFST------------RRPIEFLHRRWGTSKPLLAAMHATLLAIITVSCFFLIP--AIIFS 204

  Fly   180 KF-EGWSYFDSVYYCFITLTTIGFGDMVA----LQRDNALNRKPEYVMFALIFILFGLAIVAASL 239
            .. |.|::.:|.|:|||:|:|||.||.|.    .||...|.:..  :.|.||..|..:.:|..:.
Zfish   205 VLEEEWNFLESFYFCFISLSTIGLGDYVPGEGYHQRFRELYKLG--ITFYLILGLIAMLVVLETF 267

  Fly   240 ----------NLLVLRFVTMNTEDERR-------------DEAQAMQALQVAVKLEGDVI----- 276
                      .:..||  ...|||:..             |:|.:.:..:..: ...|::     
Zfish   268 CELQQLKKLRKMFYLR--KQKTEDQLNIVDHDHLSFASVSDQAASFREDKTEL-FPDDIVSGSPT 329

  Fly   277 -TSNGSI 282
             |||||:
Zfish   330 ATSNGSL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 24/54 (44%)
Ion_trans_2 169..247 CDD:285168 28/92 (30%)
kcnk1aNP_001092223.1 Ion_trans_2 97..158 CDD:285168 26/62 (42%)
Ion_trans_2 191..267 CDD:285168 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.