DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnk10

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001303594.1 Gene:Kcnk10 / 72258 MGIID:1919508 Length:538 Species:Mus musculus


Alignment Length:277 Identity:90/277 - (32%)
Similarity:142/277 - (51%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKQNVRTISLIVCTFTYLLVGAAVFDALES--ETEKRRWEALQDAEDMIIRKY-NISQEDFKVM 62
            ||.:.|  :::.|....||:.|..||.|||.  |:.::...||:.||  .:|.: .:|.::.:.:
Mouse    67 MKWKTV--VAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAE--FLRDHICVSPQELETL 127

  Fly    63 ETVVLKSE---------SHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
            ....|.::         |..:...|....||::|.||:||||||:..|||.|||:|.:.|||.||
Mouse   128 IQHALDADNAGVSPVGNSSNSSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGI 192

  Fly   119 PLGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIAGG--------A 175
            ||...:...||:::..:....|..|....|.|:...:::.:|..:     |.|..|        |
Mouse   193 PLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTI-----LFILAGCIVFVTIPA 252

  Fly   176 AAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNA-LNRKPEYVMFALIFILFGLAIVAASL 239
            ..|...|||:..:|:|:..:||||:||||.||  ..|| :|.:..|......:||.|||..||.|
Mouse   253 VIFKYIEGWTALESIYFVVVTLTTVGFGDFVA--GGNAGINYREWYKPLVWFWILVGLAYFAAVL 315

  Fly   240 NLL--VLRFVTMNTEDE 254
            :::  .||.::..|::|
Mouse   316 SMIGDWLRVLSKKTKEE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 28/54 (52%)
Ion_trans_2 169..247 CDD:285168 34/88 (39%)
Kcnk10NP_001303594.1 Ion_trans_2 <152..206 CDD:369572 28/53 (53%)
Ion_trans_2 244..323 CDD:369572 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2827
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.