DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnk16

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001102990.1 Gene:Kcnk16 / 688996 RGDID:1582911 Length:292 Species:Rattus norvegicus


Alignment Length:245 Identity:79/245 - (32%)
Similarity:126/245 - (51%) Gaps:14/245 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYN-ISQEDFKVMETVVL--- 67
            :.:.|::....|||:||.:|..||.:.|.:..:..|..:...:..|. :.|:..:....|:|   
  Rat    13 QVLPLLLAYICYLLLGATIFQRLEKQAEAQSRDQFQLEKLRFLENYTCLDQQALEQFVQVILEAW 77

  Fly    68 -KSESHKAG----QQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQS 127
             |..:.|..    ..|.|..:|::|.||:||||||:..|||..|::|.:.||::||||.:|....
  Rat    78 VKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALMGIPLNVVFLNH 142

  Fly   128 IGERVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTI-AGGAAAFSKFEGWSYFDSVY 191
            :|   ..|.:::....|.....:.:...:|..:.:..||.:|.| ......||..||||:.:..|
  Rat   143 LG---TGLRAHLTTLDRWEDHPRHSQLLQVLGLALFLTLGTLVILIFPPMFFSHVEGWSFREGFY 204

  Fly   192 YCFITLTTIGFGDMVALQRDNALNRKPEYVMFALIFILFGLAIVAASLNL 241
            :.||||:||||||.| :..|.:.:....|...|.|:||.|||.:|..|:|
  Rat   205 FAFITLSTIGFGDYV-VGTDPSKHYIAVYRSLAAIWILLGLAWLAVVLSL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 25/54 (46%)
Ion_trans_2 169..247 CDD:285168 32/74 (43%)
Kcnk16NP_001102990.1 Ion_trans_2 <92..148 CDD:285168 25/58 (43%)
Ion_trans_2 180..248 CDD:285168 29/68 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.