DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcnc4

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_038959057.1 Gene:Kcnc4 / 684516 RGDID:1589169 Length:663 Species:Rattus norvegicus


Alignment Length:91 Identity:24/91 - (26%)
Similarity:37/91 - (40%) Gaps:16/91 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI-----PLGLV-----MFQSIGERVNRLSSY 138
            |::|...:||:|||...|.|..|.|.....|:.|:     |:.::     |:.|:.....:|...
  Rat   428 FWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKK 492

  Fly   139 VIKAV------RSSLRCKRTVASEVD 158
            ..|.|      .|.:.||....|..|
  Rat   493 RKKHVPRPPQLESPIYCKSEETSPRD 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 16/57 (28%)
Ion_trans_2 165..243 CDD:462301
Kcnc4XP_038959057.1 Potassium_chann 1..29 CDD:431870
BTB_KCNC2_4 35..159 CDD:349722
Ion_trans 226..484 CDD:459842 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.