DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Kcna6

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_076444.1 Gene:Kcna6 / 64358 RGDID:62083 Length:530 Species:Rattus norvegicus


Alignment Length:36 Identity:17/36 - (47%)
Similarity:23/36 - (63%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 AFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118
            ||::|...:||:|||...|.|||||:.....||.|:
  Rat   413 AFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGV 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 17/36 (47%)
Ion_trans_2 165..243 CDD:462301
Kcna6NP_076444.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
BTB_POZ_KCNA6 41..170 CDD:349714
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..239
Ion_trans 258..469 CDD:459842 17/36 (47%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 361..374
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 423..428 3/4 (75%)
PDZ-binding. /evidence=ECO:0000255 527..529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.