DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and Shawl

DIOPT Version :10

Sequence 1:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001097131.2 Gene:Shawl / 5740840 FlyBaseID:FBgn0085395 Length:937 Species:Drosophila melanogaster


Alignment Length:150 Identity:38/150 - (25%)
Similarity:54/150 - (36%) Gaps:40/150 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVL 67
            |.:.:.::|:|   .:|::|...|.:|....||     |||..|          ..||       
  Fly   405 KASAKELTLLV---FFLVLGIVFFASLAYYAEK-----LQDNPD----------NQFK------- 444

  Fly    68 KSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERV 132
               |...|..|        |...:||:|||...|.|..|.......|:.|:   |.:...:...|
  Fly   445 ---SIPLGLWW--------AIVTMTTVGYGDVAPKTYPGMFVGALCALAGV---LTIALPVPVIV 495

  Fly   133 NRLSS-YVIKAVRSSLRCKR 151
            :..|. |.....||.|..||
  Fly   496 SNFSMFYSHTQARSKLPKKR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 13/53 (25%)
Ion_trans_2 165..243 CDD:462301
ShawlNP_001097131.2 BTB_Shaw-like 4..115 CDD:349723
Ion_trans 307..506 CDD:459842 33/139 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.