DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and kcnk2b

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001032475.1 Gene:kcnk2b / 568565 ZFINID:ZDB-GENE-051120-69 Length:384 Species:Danio rerio


Alignment Length:297 Identity:86/297 - (28%)
Similarity:142/297 - (47%) Gaps:63/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVME-- 63
            |:.:.|.::.|:|  ..||::||.||..||     :.:|.||        |.||..|..:.:|  
Zfish     1 MRWKTVLSVFLLV--VLYLILGATVFKELE-----QPYETLQ--------KLNILMEKLEFLEQH 50

  Fly    64 ---------------TVVLKSESHKAGQQ------WKFTGAFYYATTVLTTIGYGHSTPSTVGGK 107
                           ...|::..:.:|..      |..:.:|:::.||:||||:|:.:|.|..|:
Zfish    51 PCVNSSDLENLVKQVVSALRAGVNPSGNSSNQSSLWDLSNSFFFSGTVITTIGFGNISPHTEVGR 115

  Fly   108 LFTMCYAIVGIPLGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVASEVDLICVVTTLSSLTIA 172
            :|.:.||::||||...:...:|:::..:....|..|...:. |..|:.  ..|.|::||  |.|.
Zfish   116 IFCIIYALLGIPLFGFLLAGVGDQLGTIFGKAIAKVEGMID-KWNVSQ--TKIRVISTL--LFIL 175

  Fly   173 GG--------AAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQRDNALNRKP------EYVMF 223
            .|        |..|...||||..:|:|:..||||||||||.||.:.:...:.:.      ||:.:
Zfish   176 FGCLLFVTLPAVIFKHIEGWSALESIYFVVITLTTIGFGDFVAGEAERRHHEESSGGSQLEYLDY 240

  Fly   224 ----ALIFILFGLAIVAASLNLL--VLRFVTMNTEDE 254
                ...:||.|||..||.|:::  ..|.::..|::|
Zfish   241 YKPLVWFWILVGLAYFAAVLSMIGDWFRVISKKTKEE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 20/60 (33%)
Ion_trans_2 169..247 CDD:285168 34/97 (35%)
kcnk2bNP_001032475.1 Ion_trans_2 <86..140 CDD:285168 20/53 (38%)
Ion_trans_2 178..268 CDD:285168 30/89 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.