DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Task6 and KCNK12

DIOPT Version :9

Sequence 1:NP_001262541.1 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_071338.1 Gene:KCNK12 / 56660 HGNCID:6274 Length:430 Species:Homo sapiens


Alignment Length:404 Identity:98/404 - (24%)
Similarity:163/404 - (40%) Gaps:124/404 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RTISLIVCTFTYLLVGAAVFDALES--ETEKR-RWEALQDAEDMIIRKYN----ISQEDFKVM-- 62
            |.:.|......||:.||.||.||||  |.|.| ||.|       .:|.::    :::.:.:..  
Human    38 RFVLLAALIGLYLVAGATVFSALESPGEAEARARWGA-------TLRNFSAAHGVAEPELRAFLR 95

  Fly    63 ---ETVVLKSESHKAGQQWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVM 124
               ..:.....:.....:|.|.||||:..||::|||:|.:||:|||||.|.:.|.:.|....::.
Human    96 HYEAALAAGVRADALRPRWDFPGAFYFVGTVVSTIGFGMTTPATVGGKAFLIAYGLFGCAGTILF 160

  Fly   125 FQSIGERVNRLSSYVIKAVRS-SLR---------CKRTVASEVD-----------LICVVTTLSS 168
            |....||:..|.:::::|.|. .||         .:.:..||.|           ::.::...:.
Human   161 FNLFLERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYHVLLILGLFAV 225

  Fly   169 LTIAGGAAAFSKFEGWSYFDSVYYCFITLTTIGFGDMVALQ----RDNALNRKPEYVMFALIFIL 229
            |.....:|.::..|||.|.||:|:||:|.:||||||:|:.|    |:..|.|...:     :|||
Human   226 LLSCCASAMYTSVEGWDYVDSLYFCFVTFSTIGFGDLVSSQHAAYRNQGLYRLGNF-----LFIL 285

  Fly   230 FGLAIVAASLNLLVLRFVTMNTEDERRDEAQAMQALQVAVKLEGDVITSNGSILSGYEGHDGQSL 294
            .|:..:.:..|:                       :.:.:|                     |.|
Human   286 LGVCCIYSLFNV-----------------------ISILIK---------------------QVL 306

  Fly   295 NGSNTSSMCSCHCIC--------------LNGNRHKK------SSNLEKNNDAENQYKLRQSPTH 339
            |.......|.|...|              ..|:|.::      :....:::|||.          
Human   307 NWMLRKLSCRCCARCCPAPGAPLARRNAITPGSRLRRRLAALGADPAARDSDAEG---------- 361

  Fly   340 IRHLLPEVVPMQDL 353
             |.|..|::.|:||
Human   362 -RRLSGELISMRDL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Task6NP_001262541.1 Ion_trans_2 <77..132 CDD:285168 24/54 (44%)
Ion_trans_2 169..247 CDD:285168 28/81 (35%)
KCNK12NP_071338.1 Ion_trans_2 101..169 CDD:400301 25/67 (37%)
Ion_trans_2 222..304 CDD:400301 29/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155127
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.